Anti MAK16 pAb (ATL-HPA050574 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA050574-25
  • Immunohistochemical staining of human cerebellum shows distinct nucleolar positivity in Purkinje cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoli & vesicles.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and MAK16 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410084).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: MAK16 homolog (S. cerevisiae)
Gene Name: MAK16
Alternative Gene Name: MAK16L, RBM13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031578: 99%, ENSRNOG00000010783: 97%
Entrez Gene ID: 84549
Uniprot ID: Q9BXY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FIRHKCKQRFTKITQYLIRIRKLTLKRQRKLVPLSKKVERREKRREEKALIAAQLDNAIEKELLERLKQDTYGDIYNFPIHAFDKALEQQ
Gene Sequence FIRHKCKQRFTKITQYLIRIRKLTLKRQRKLVPLSKKVERREKRREEKALIAAQLDNAIEKELLERLKQDTYGDIYNFPIHAFDKALEQQ
Gene ID - Mouse ENSMUSG00000031578
Gene ID - Rat ENSRNOG00000010783
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MAK16 pAb (ATL-HPA050574 w/enhanced validation)
Datasheet Anti MAK16 pAb (ATL-HPA050574 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MAK16 pAb (ATL-HPA050574 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MAK16 pAb (ATL-HPA050574 w/enhanced validation)
Datasheet Anti MAK16 pAb (ATL-HPA050574 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MAK16 pAb (ATL-HPA050574 w/enhanced validation)