Anti MAGEF1 pAb (ATL-HPA054190)

Atlas Antibodies

SKU:
ATL-HPA054190-25
  • Immunofluorescent staining of human cell line HEK 293 shows localization to actin filaments.
  • Western blot analysis in human cell line TD47D.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: melanoma antigen family F1
Gene Name: MAGEF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000100937: 49%, ENSRNOG00000055506: 54%
Entrez Gene ID: 64110
Uniprot ID: Q9HAY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLVKDKKKSPITRSEMVKYVIGDLKILFPDIIARAAEHLRYVFGFELKQFDRKHHTYILINKLKPLE
Gene Sequence LLVKDKKKSPITRSEMVKYVIGDLKILFPDIIARAAEHLRYVFGFELKQFDRKHHTYILINKLKPLE
Gene ID - Mouse ENSMUSG00000100937
Gene ID - Rat ENSRNOG00000055506
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MAGEF1 pAb (ATL-HPA054190)
Datasheet Anti MAGEF1 pAb (ATL-HPA054190) Datasheet (External Link)
Vendor Page Anti MAGEF1 pAb (ATL-HPA054190) at Atlas Antibodies

Documents & Links for Anti MAGEF1 pAb (ATL-HPA054190)
Datasheet Anti MAGEF1 pAb (ATL-HPA054190) Datasheet (External Link)
Vendor Page Anti MAGEF1 pAb (ATL-HPA054190)