Anti MAGEF1 pAb (ATL-HPA046899 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA046899-25

• 
• 

Protein Description: melanoma antigen family F, 1
Gene Name: MAGEF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048661: 34%, ENSRNOG00000014851: 32%
Entrez Gene ID: 64110
Uniprot ID: Q9HAY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLQTPESRGLPVPQAEGEKDGGHDGETRAPTASQERPKEELGAGREEGAAEPALTRKGA
• Gene Sequence: MLQTPESRGLPVPQAEGEKDGGHDGETRAPTASQERPKEELGAGREEGAAEPALTRKGA
• Gene ID - Mouse: ENSMUSG00000048661
• Gene ID - Rat: ENSRNOG00000014851
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.