Anti MAGEB5 pAb (ATL-HPA052627)

Atlas Antibodies

SKU: ATL-HPA052627-25

• 

Protein Description: melanoma antigen family B, 5
Gene Name: MAGEB5
Alternative Gene Name: CT3.3, MAGE-B5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043453: 33%, ENSRNOG00000052773: 30%
Entrez Gene ID: 347541
Uniprot ID: Q9BZ81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NAGSDERANSRDEEYPCSSEVSPSTESSCSNFINIKVGLLEQFLLY
• Gene Sequence: NAGSDERANSRDEEYPCSSEVSPSTESSCSNFINIKVGLLEQFLLY
• Gene ID - Mouse: ENSMUSG00000043453
• Gene ID - Rat: ENSRNOG00000052773
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.