Anti MAGEA11 pAb (ATL-HPA052687)

Atlas Antibodies

SKU: ATL-HPA052687-25

• 

Protein Description: melanoma antigen family A11
Gene Name: MAGEA11
Alternative Gene Name: CT1.11, MAGE-11, MAGE11, MAGEA-11, MGC10511
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031179: 45%, ENSRNOG00000054784: 43%
Entrez Gene ID: 4110
Uniprot ID: P43364
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEM
• Gene Sequence: PSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEM
• Gene ID - Mouse: ENSMUSG00000031179
• Gene ID - Rat: ENSRNOG00000054784
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.