Anti-MAF1 pAb (ATL-HPA072409)

Catalog No:
ATL-HPA072409-100
$596.00
Polyclonal Antibody against Human MAF1, Gene description: MAF1 homolog, negative regulator of RNA polymerase III, Alternative Gene Names: DKFZp586G1123, Validated applications: ICC, Uniprot ID: Q9H063, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence FSAVREDFKDLKPQLWNAVDEEICLAECDIYSYNPDLDSDPFGEDGSLWSFNYFFYNKRLKRIVFFSC
Gene ID - Mouse ENSMUSG00000022553
Gene ID - Rat ENSMUSG00000022553
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti-MAF1 pAb (ATL-HPA072409)
Vendor Page Anti-MAF1 pAb (ATL-HPA072409) at Atlas

Documents & Links for Anti-MAF1 pAb (ATL-HPA072409)
Vendor Page Anti-MAF1 pAb (ATL-HPA072409)