Polyclonal Antibody against Human MAF1, Gene description: MAF1 homolog, negative regulator of RNA polymerase III, Alternative Gene Names: DKFZp586G1123, Validated applications: ICC, Uniprot ID: Q9H063, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FSAVREDFKDLKPQLWNAVDEEICLAECDIYSYNPDLDSDPFGEDGSLWSFNYFFYNKRLKRIVFFSC |
Gene ID - Mouse | ENSMUSG00000022553 |
Gene ID - Rat | ENSMUSG00000022553 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti-MAF1 pAb (ATL-HPA072409) | |
Vendor Page | Anti-MAF1 pAb (ATL-HPA072409) at Atlas |
Documents & Links for Anti-MAF1 pAb (ATL-HPA072409) | |
Vendor Page | Anti-MAF1 pAb (ATL-HPA072409) |