Protein Description: MACRO domain containing 1
Gene Name: MACROD1
Alternative Gene Name: LRP16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036278: 91%, ENSRNOG00000021174: 91%
Entrez Gene ID: 28992
Uniprot ID: Q9BQ69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MACROD1
Alternative Gene Name: LRP16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036278: 91%, ENSRNOG00000021174: 91%
Entrez Gene ID: 28992
Uniprot ID: Q9BQ69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AEIVLATLREWLEQHKDKVDRLIICVFLEKDEDIYRSRLPHYFPVA |
| Documents & Links for Anti MACROD1 pAb (ATL-HPA071075) | |
| Datasheet | Anti MACROD1 pAb (ATL-HPA071075) Datasheet (External Link) |
| Vendor Page | Anti MACROD1 pAb (ATL-HPA071075) at Atlas |
| Documents & Links for Anti MACROD1 pAb (ATL-HPA071075) | |
| Datasheet | Anti MACROD1 pAb (ATL-HPA071075) Datasheet (External Link) |
| Vendor Page | Anti MACROD1 pAb (ATL-HPA071075) |