Anti M1AP pAb (ATL-HPA059302)

Atlas Antibodies

SKU: ATL-HPA059302-25

• 

Protein Description: meiosis 1 associated protein
Gene Name: M1AP
Alternative Gene Name: C2orf65, D6Mm5e, SPATA37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030041: 81%, ENSRNOG00000007288: 80%
Entrez Gene ID: 130951
Uniprot ID: Q8TC57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSWADICTNLCEALQNFFSLACSLMGPSRMSLFSLYMVQDQHECILPFVQVKGNFARLQTCISELRMLQREGCFRSQGASLRLAVEDGLQQFKQYSR
• Gene Sequence: PSWADICTNLCEALQNFFSLACSLMGPSRMSLFSLYMVQDQHECILPFVQVKGNFARLQTCISELRMLQREGCFRSQGASLRLAVEDGLQQFKQYSR
• Gene ID - Mouse: ENSMUSG00000030041
• Gene ID - Rat: ENSRNOG00000007288
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.