Anti M1AP pAb (ATL-HPA045420)

Atlas Antibodies

SKU: ATL-HPA045420-25

• 
• 

Protein Description: meiosis 1 associated protein
Gene Name: M1AP
Alternative Gene Name: C2orf65, D6Mm5e, SPATA37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030041: 80%, ENSRNOG00000007288: 80%
Entrez Gene ID: 130951
Uniprot ID: Q8TC57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RMDDPKGDFITLYQMASQSSASHYKLQVIKALKSSGLCESLTYGLPFILRPTSCWQLDWDELETNQQHFHALCHSLLKREWLLLAKGEPPGPGHSQRIPAST
• Gene Sequence: RMDDPKGDFITLYQMASQSSASHYKLQVIKALKSSGLCESLTYGLPFILRPTSCWQLDWDELETNQQHFHALCHSLLKREWLLLAKGEPPGPGHSQRIPAST
• Gene ID - Mouse: ENSMUSG00000030041
• Gene ID - Rat: ENSRNOG00000007288
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti M1AP pAb (ATL-HPA045420) – 1 Found

Wyrwoll, Margot J; Temel, Şehime G; Nagirnaja, Liina; Oud, Manon S; Lopes, Alexandra M; van der Heijden, Godfried W; Heald, James S; Rotte, Nadja; Wistuba, Joachim; Wöste, Marius; Ledig, Susanne; Krenz, Henrike; Smits, Roos M; Carvalho, Filipa; Gonçalves, João; Fietz, Daniela; Türkgenç, Burcu; Ergören, Mahmut C; Çetinkaya, Murat; Başar, Murad; Kahraman, Semra; McEleny, Kevin; Xavier, Miguel J; Turner, Helen; Pilatz, Adrian; Röpke, Albrecht; Dugas, Martin; Kliesch, Sabine; Neuhaus, Nina; Aston, Kenneth I; Conrad, Donald F; Veltman, Joris A; Friedrich, Corinna; Tüttelmann, Frank. Bi-allelic Mutations in M1AP Are a Frequent Cause of Meiotic Arrest and Severely Impaired Spermatogenesis Leading to Male Infertility. American Journal Of Human Genetics. 2020;107(2):342-351.