Anti LZTFL1 pAb (ATL-HPA048447 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA048447-25

• 

Protein Description: leucine zipper transcription factor-like 1
Gene Name: LZTFL1
Alternative Gene Name: BBS17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025245: 97%, ENSRNOG00000006244: 99%
Entrez Gene ID: 54585
Uniprot ID: Q9NQ48
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AELGLNEHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKESRLVEDTFTIDEVSEVLNGLQAVVHSEVESELIN
• Gene Sequence: AELGLNEHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKESRLVEDTFTIDEVSEVLNGLQAVVHSEVESELIN
• Gene ID - Mouse: ENSMUSG00000025245
• Gene ID - Rat: ENSRNOG00000006244
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.