Anti LYPLAL1 pAb (ATL-HPA045806)

Atlas Antibodies

SKU:
ATL-HPA045806-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules and in glomeruli.
  • Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: lysophospholipase-like 1
Gene Name: LYPLAL1
Alternative Gene Name: Q96AV0
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039246: 82%, ENSRNOG00000023130: 83%
Entrez Gene ID: 127018
Uniprot ID: Q5VWZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSF
Gene Sequence PMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSF
Gene ID - Mouse ENSMUSG00000039246
Gene ID - Rat ENSRNOG00000023130
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LYPLAL1 pAb (ATL-HPA045806)
Datasheet Anti LYPLAL1 pAb (ATL-HPA045806) Datasheet (External Link)
Vendor Page Anti LYPLAL1 pAb (ATL-HPA045806) at Atlas Antibodies

Documents & Links for Anti LYPLAL1 pAb (ATL-HPA045806)
Datasheet Anti LYPLAL1 pAb (ATL-HPA045806) Datasheet (External Link)
Vendor Page Anti LYPLAL1 pAb (ATL-HPA045806)