Anti LY9 pAb (ATL-HPA050917)

Atlas Antibodies

SKU:
ATL-HPA050917-25
  • Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: lymphocyte antigen 9
Gene Name: LY9
Alternative Gene Name: CD229, hly9, mLY9, SLAMF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004707: 48%, ENSRNOG00000025069: 48%
Entrez Gene ID: 4063
Uniprot ID: Q9HBG7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRKGRCSVPAFCSSQAEAPADTPEPTAGHTLYSVLSQGYEKLDTPLRPARQQPTPTSDSSSDSNLTTEEDEDRPEVHKPISGRYE
Gene Sequence KRKGRCSVPAFCSSQAEAPADTPEPTAGHTLYSVLSQGYEKLDTPLRPARQQPTPTSDSSSDSNLTTEEDEDRPEVHKPISGRYE
Gene ID - Mouse ENSMUSG00000004707
Gene ID - Rat ENSRNOG00000025069
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LY9 pAb (ATL-HPA050917)
Datasheet Anti LY9 pAb (ATL-HPA050917) Datasheet (External Link)
Vendor Page Anti LY9 pAb (ATL-HPA050917) at Atlas Antibodies

Documents & Links for Anti LY9 pAb (ATL-HPA050917)
Datasheet Anti LY9 pAb (ATL-HPA050917) Datasheet (External Link)
Vendor Page Anti LY9 pAb (ATL-HPA050917)