Anti LY75 pAb (ATL-HPA054073)

Atlas Antibodies

SKU:
ATL-HPA054073-25
  • Immunofluorescent staining of human cell line CACO-2 shows localization to the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: lymphocyte antigen 75
Gene Name: LY75
Alternative Gene Name: CD205, CLEC13B, DEC-205
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026980: 67%, ENSRNOG00000007012: 47%
Entrez Gene ID: 4065
Uniprot ID: O60449
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QRHRLHLAGFSSVRYAQGVNEDEIMLPSFH
Gene Sequence QRHRLHLAGFSSVRYAQGVNEDEIMLPSFH
Gene ID - Mouse ENSMUSG00000026980
Gene ID - Rat ENSRNOG00000007012
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LY75 pAb (ATL-HPA054073)
Datasheet Anti LY75 pAb (ATL-HPA054073) Datasheet (External Link)
Vendor Page Anti LY75 pAb (ATL-HPA054073) at Atlas Antibodies

Documents & Links for Anti LY75 pAb (ATL-HPA054073)
Datasheet Anti LY75 pAb (ATL-HPA054073) Datasheet (External Link)
Vendor Page Anti LY75 pAb (ATL-HPA054073)