Anti LY75 pAb (ATL-HPA049108)

Atlas Antibodies

SKU:
ATL-HPA049108-25
  • Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: lymphocyte antigen 75
Gene Name: LY75
Alternative Gene Name: CD205, CLEC13B, DEC-205
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026980: 77%, ENSRNOG00000007012: 76%
Entrez Gene ID: 4065
Uniprot ID: O60449
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRWTAYEKINKWTDNRELTYSNFHPLLVSGRLRIPENFFEEESRYHCALILNLQKSPFTGTWNFTSCSERHFVSLCQKYSEVKSRQTLQNASETVKYLNN
Gene Sequence LRWTAYEKINKWTDNRELTYSNFHPLLVSGRLRIPENFFEEESRYHCALILNLQKSPFTGTWNFTSCSERHFVSLCQKYSEVKSRQTLQNASETVKYLNN
Gene ID - Mouse ENSMUSG00000026980
Gene ID - Rat ENSRNOG00000007012
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LY75 pAb (ATL-HPA049108)
Datasheet Anti LY75 pAb (ATL-HPA049108) Datasheet (External Link)
Vendor Page Anti LY75 pAb (ATL-HPA049108) at Atlas Antibodies

Documents & Links for Anti LY75 pAb (ATL-HPA049108)
Datasheet Anti LY75 pAb (ATL-HPA049108) Datasheet (External Link)
Vendor Page Anti LY75 pAb (ATL-HPA049108)