Anti LVRN pAb (ATL-HPA053254 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA053254-25

• 

Protein Description: laeverin
Gene Name: LVRN
Alternative Gene Name: APQ, AQPEP, FLJ90650, TAQPEP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024481: 60%, ENSRNOG00000003950: 61%
Entrez Gene ID: 206338
Uniprot ID: Q6Q4G3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPYPIKDVVLCYGIALGSDKEWDILLNTYTNTTNKEEKIQLAYAMSCSKDPWILNRYMEYAISTSPFTSNETNIIEVVASSEVGRYVA
• Gene Sequence: IPYPIKDVVLCYGIALGSDKEWDILLNTYTNTTNKEEKIQLAYAMSCSKDPWILNRYMEYAISTSPFTSNETNIIEVVASSEVGRYVA
• Gene ID - Mouse: ENSMUSG00000024481
• Gene ID - Rat: ENSRNOG00000003950
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.