Anti LTF pAb (ATL-HPA059976 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA059976-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: LTF
Alternative Gene Name: HLF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032496: 77%, ENSRNOG00000031779: 69%
Entrez Gene ID: 4057
Uniprot ID: P02788
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGK |
| Gene Sequence | PNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGK |
| Gene ID - Mouse | ENSMUSG00000032496 |
| Gene ID - Rat | ENSRNOG00000031779 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LTF pAb (ATL-HPA059976 w/enhanced validation) | |
| Datasheet | Anti LTF pAb (ATL-HPA059976 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LTF pAb (ATL-HPA059976 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti LTF pAb (ATL-HPA059976 w/enhanced validation) | |
| Datasheet | Anti LTF pAb (ATL-HPA059976 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LTF pAb (ATL-HPA059976 w/enhanced validation) |
| Citations for Anti LTF pAb (ATL-HPA059976 w/enhanced validation) – 1 Found |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |