Anti LTB pAb (ATL-HPA048884)

Atlas Antibodies

SKU: ATL-HPA048884-25

• 
• 

Protein Description: lymphotoxin beta (TNF superfamily, member 3)
Gene Name: LTB
Alternative Gene Name: p33, TNFC, TNFSF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024399: 53%, ENSRNOG00000058566: 53%
Entrez Gene ID: 4050
Uniprot ID: Q06643
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSD
• Gene Sequence: GGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSD
• Gene ID - Mouse: ENSMUSG00000024399
• Gene ID - Rat: ENSRNOG00000058566
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LTB pAb (ATL-HPA048884) – 1 Found

Cox, Sharon Natasha; Chiurlia, Samantha; Divella, Chiara; Rossini, Michele; Serino, Grazia; Bonomini, Mario; Sirolli, Vittorio; Aiello, Francesca B; Zaza, Gianluigi; Squarzoni, Isabella; Gangemi, Concetta; Stangou, Maria; Papagianni, Aikaterini; Haas, Mark; Schena, Francesco Paolo. Formalin-fixed paraffin-embedded renal biopsy tissues: an underexploited biospecimen resource for gene expression profiling in IgA nephropathy. Scientific Reports. 2020;10(1):15164.