Anti LSM6 pAb (ATL-HPA045079)

Atlas Antibodies

SKU: ATL-HPA045079-25

• 
• 

Protein Description: LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Gene Name: LSM6
Alternative Gene Name: YDR378C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031683: 100%, ENSRNOG00000049370: 100%
Entrez Gene ID: 11157
Uniprot ID: P62312
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM
• Gene Sequence: MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM
• Gene ID - Mouse: ENSMUSG00000031683
• Gene ID - Rat: ENSRNOG00000049370
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.