Anti LSM3 pAb (ATL-HPA044966)

Atlas Antibodies

SKU:
ATL-HPA044966-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in subset of cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Gene Name: LSM3
Alternative Gene Name: SMX4, USS2, YLR438C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034192: 100%, ENSRNOG00000008733: 100%
Entrez Gene ID: 27258
Uniprot ID: P62310
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDG
Gene Sequence DDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDG
Gene ID - Mouse ENSMUSG00000034192
Gene ID - Rat ENSRNOG00000008733
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LSM3 pAb (ATL-HPA044966)
Datasheet Anti LSM3 pAb (ATL-HPA044966) Datasheet (External Link)
Vendor Page Anti LSM3 pAb (ATL-HPA044966) at Atlas Antibodies

Documents & Links for Anti LSM3 pAb (ATL-HPA044966)
Datasheet Anti LSM3 pAb (ATL-HPA044966) Datasheet (External Link)
Vendor Page Anti LSM3 pAb (ATL-HPA044966)