Anti LSM12 pAb (ATL-HPA051934)

Atlas Antibodies

SKU:
ATL-HPA051934-25
  • Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line PC-3 shows localization to cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: LSM12 homolog (S. cerevisiae)
Gene Name: LSM12
Alternative Gene Name: FLJ30656
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020922: 100%, ENSRNOG00000020894: 100%
Entrez Gene ID: 124801
Uniprot ID: Q3MHD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPSSSGKPNHADILLINLQYVSEVEIINDRTETPPPLASLNVSK
Gene Sequence PGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPSSSGKPNHADILLINLQYVSEVEIINDRTETPPPLASLNVSK
Gene ID - Mouse ENSMUSG00000020922
Gene ID - Rat ENSRNOG00000020894
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LSM12 pAb (ATL-HPA051934)
Datasheet Anti LSM12 pAb (ATL-HPA051934) Datasheet (External Link)
Vendor Page Anti LSM12 pAb (ATL-HPA051934) at Atlas Antibodies

Documents & Links for Anti LSM12 pAb (ATL-HPA051934)
Datasheet Anti LSM12 pAb (ATL-HPA051934) Datasheet (External Link)
Vendor Page Anti LSM12 pAb (ATL-HPA051934)