Protein Description: leucine rich repeat and coiled-coil centrosomal protein 1
Gene Name: LRRCC1
Alternative Gene Name: CLERC, KIAA1764, VFL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027550: 65%, ENSRNOG00000010891: 67%
Entrez Gene ID: 85444
Uniprot ID: Q9C099
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LRRCC1
Alternative Gene Name: CLERC, KIAA1764, VFL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027550: 65%, ENSRNOG00000010891: 67%
Entrez Gene ID: 85444
Uniprot ID: Q9C099
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KIPYDAKTIQTIKHHNKNYNSFVSCNRKMKPPYLKELYVSSSLANCPMLQESEKPKTEIIKVDQSHSEDNTYQSLVEQLDQEREKRWRAEQAENK |
| Documents & Links for Anti LRRCC1 pAb (ATL-HPA075880) | |
| Datasheet | Anti LRRCC1 pAb (ATL-HPA075880) Datasheet (External Link) |
| Vendor Page | Anti LRRCC1 pAb (ATL-HPA075880) at Atlas |
| Documents & Links for Anti LRRCC1 pAb (ATL-HPA075880) | |
| Datasheet | Anti LRRCC1 pAb (ATL-HPA075880) Datasheet (External Link) |
| Vendor Page | Anti LRRCC1 pAb (ATL-HPA075880) |