Anti LRRCC1 pAb (ATL-HPA075880)
Atlas Antibodies
- SKU:
- ATL-HPA075880-25
- Shipping:
- Calculated at Checkout
$303.00
Product Description
Protein Description: leucine rich repeat and coiled-coil centrosomal protein 1
Gene Name: LRRCC1
Alternative Gene Name: CLERC, KIAA1764, VFL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027550: 65%, ENSRNOG00000010891: 67%
Entrez Gene ID: 85444
Uniprot ID: Q9C099
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LRRCC1
Alternative Gene Name: CLERC, KIAA1764, VFL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027550: 65%, ENSRNOG00000010891: 67%
Entrez Gene ID: 85444
Uniprot ID: Q9C099
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KIPYDAKTIQTIKHHNKNYNSFVSCNRKMKPPYLKELYVSSSLANCPMLQESEKPKTEIIKVDQSHSEDNTYQSLVEQLDQEREKRWRAEQAENK |
Gene Sequence | KIPYDAKTIQTIKHHNKNYNSFVSCNRKMKPPYLKELYVSSSLANCPMLQESEKPKTEIIKVDQSHSEDNTYQSLVEQLDQEREKRWRAEQAENK |
Gene ID - Mouse | ENSMUSG00000027550 |
Gene ID - Rat | ENSRNOG00000010891 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti LRRCC1 pAb (ATL-HPA075880) | |
Datasheet | Anti LRRCC1 pAb (ATL-HPA075880) Datasheet (External Link) |
Vendor Page | Anti LRRCC1 pAb (ATL-HPA075880) at Atlas Antibodies |
Documents & Links for Anti LRRCC1 pAb (ATL-HPA075880) | |
Datasheet | Anti LRRCC1 pAb (ATL-HPA075880) Datasheet (External Link) |
Vendor Page | Anti LRRCC1 pAb (ATL-HPA075880) |