Anti LRRC73 pAb (ATL-HPA046698 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA046698-25
  • Immunohistochemistry analysis in human testis and prostate tissues using Anti-LRRC73 antibody. Corresponding LRRC73 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 73
Gene Name: LRRC73
Alternative Gene Name: C6orf154, dJ337H4.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071073: 100%, ENSRNOG00000039856: 100%
Entrez Gene ID: 221424
Uniprot ID: Q5JTD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICRALAGATSLAQLNLNLGVVSSPSRIKQLAEALRTNRSIQSLFLHGS
Gene Sequence MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICRALAGATSLAQLNLNLGVVSSPSRIKQLAEALRTNRSIQSLFLHGS
Gene ID - Mouse ENSMUSG00000071073
Gene ID - Rat ENSRNOG00000039856
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti LRRC73 pAb (ATL-HPA046698 w/enhanced validation)
Datasheet Anti LRRC73 pAb (ATL-HPA046698 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LRRC73 pAb (ATL-HPA046698 w/enhanced validation)