Anti LRRC58 pAb (ATL-HPA057574)

Atlas Antibodies

SKU:
ATL-HPA057574-25
  • Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in a subset of hematopoietic cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 58
Gene Name: LRRC58
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034158: 97%, ENSRNOG00000027151: 98%
Entrez Gene ID: 116064
Uniprot ID: Q96CX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSLGGNQLQSIPAEIENLQSLECLYLGGNFIKEIPPELGNLPSLNYLVLCDNKIQSIPPQLSQLHSLRSLSLHNNLLTYLPREILNLIHLEEL
Gene Sequence LSLGGNQLQSIPAEIENLQSLECLYLGGNFIKEIPPELGNLPSLNYLVLCDNKIQSIPPQLSQLHSLRSLSLHNNLLTYLPREILNLIHLEEL
Gene ID - Mouse ENSMUSG00000034158
Gene ID - Rat ENSRNOG00000027151
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LRRC58 pAb (ATL-HPA057574)
Datasheet Anti LRRC58 pAb (ATL-HPA057574) Datasheet (External Link)
Vendor Page Anti LRRC58 pAb (ATL-HPA057574) at Atlas Antibodies

Documents & Links for Anti LRRC58 pAb (ATL-HPA057574)
Datasheet Anti LRRC58 pAb (ATL-HPA057574) Datasheet (External Link)
Vendor Page Anti LRRC58 pAb (ATL-HPA057574)