Anti LRRC53 pAb (ATL-HPA054062)
Atlas Antibodies
- SKU:
- ATL-HPA054062-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LRRC53
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051228: 29%, ENSRNOG00000009646: 29%
Entrez Gene ID: 105378803
Uniprot ID: A6NM62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VDLSRNRLAHMPDVFTPLKQLILLSLDKNQWSCTCDLHPLARFLRNYIKSSAHTLRNAKDLNCQPSTAAVAAAQSVLRLSETNCDSKAPNFTLVL |
Gene Sequence | VDLSRNRLAHMPDVFTPLKQLILLSLDKNQWSCTCDLHPLARFLRNYIKSSAHTLRNAKDLNCQPSTAAVAAAQSVLRLSETNCDSKAPNFTLVL |
Gene ID - Mouse | ENSMUSG00000051228 |
Gene ID - Rat | ENSRNOG00000009646 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LRRC53 pAb (ATL-HPA054062) | |
Datasheet | Anti LRRC53 pAb (ATL-HPA054062) Datasheet (External Link) |
Vendor Page | Anti LRRC53 pAb (ATL-HPA054062) at Atlas Antibodies |
Documents & Links for Anti LRRC53 pAb (ATL-HPA054062) | |
Datasheet | Anti LRRC53 pAb (ATL-HPA054062) Datasheet (External Link) |
Vendor Page | Anti LRRC53 pAb (ATL-HPA054062) |