Anti LRRC42 pAb (ATL-HPA050537)

Atlas Antibodies

SKU: ATL-HPA050537-25

• 
• 

Protein Description: leucine rich repeat containing 42
Gene Name: LRRC42
Alternative Gene Name: MGC8974
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028617: 94%, ENSRNOG00000009983: 93%
Entrez Gene ID: 115353
Uniprot ID: Q9Y546
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YGSLVLCSLCLRNRYLVISEKLEEIKSFRELTCLDLSCCKLGDEHELLEHLTNEALSSVTQLHLKDNCLSDAGVRKMTAPVRVMKR
• Gene Sequence: YGSLVLCSLCLRNRYLVISEKLEEIKSFRELTCLDLSCCKLGDEHELLEHLTNEALSSVTQLHLKDNCLSDAGVRKMTAPVRVMKR
• Gene ID - Mouse: ENSMUSG00000028617
• Gene ID - Rat: ENSRNOG00000009983
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.