Anti LRRC41 pAb (ATL-HPA051941)
Atlas Antibodies
- SKU:
- ATL-HPA051941-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: LRRC41
Alternative Gene Name: MUF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028703: 97%, ENSRNOG00000013642: 96%
Entrez Gene ID: 10489
Uniprot ID: Q15345
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KPLKRFKRAAGKKGARTRQGPGAESEDLYDFVFIVAGEKEDGEEMEIGEVACGALDGSDPSCLGLPALEASQRF |
| Gene Sequence | KPLKRFKRAAGKKGARTRQGPGAESEDLYDFVFIVAGEKEDGEEMEIGEVACGALDGSDPSCLGLPALEASQRF |
| Gene ID - Mouse | ENSMUSG00000028703 |
| Gene ID - Rat | ENSRNOG00000013642 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LRRC41 pAb (ATL-HPA051941) | |
| Datasheet | Anti LRRC41 pAb (ATL-HPA051941) Datasheet (External Link) |
| Vendor Page | Anti LRRC41 pAb (ATL-HPA051941) at Atlas Antibodies |
| Documents & Links for Anti LRRC41 pAb (ATL-HPA051941) | |
| Datasheet | Anti LRRC41 pAb (ATL-HPA051941) Datasheet (External Link) |
| Vendor Page | Anti LRRC41 pAb (ATL-HPA051941) |
| Citations for Anti LRRC41 pAb (ATL-HPA051941) – 1 Found |
| Lee, Soo Jung; Kondepudi, Akhil; Young, Kelly Z; Zhang, Xiaojie; Cartee, Naw May Pearl; Chen, Jijun; Jang, Krystal Yujin; Xu, Gang; Borjigin, Jimo; Wang, Michael M. Concentration of non-myocyte proteins in arterial media of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Plos One. 18(2):e0281094. PubMed |