Anti LRRC37A2 pAb (ATL-HPA045090)

Atlas Antibodies

SKU: ATL-HPA045090-25

• 
• 

Protein Description: leucine rich repeat containing 37, member A2
Gene Name: LRRC37A2
Alternative Gene Name: FLJ45049
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034239: 51%, ENSRNOG00000042833: 63%
Entrez Gene ID: 474170
Uniprot ID: A6NM11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKSLINSPSQGAFSSLGDLSPQENPFLEVSAPSEH
• Gene Sequence: AKSLINSPSQGAFSSLGDLSPQENPFLEVSAPSEH
• Gene ID - Mouse: ENSMUSG00000034239
• Gene ID - Rat: ENSRNOG00000042833
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.