Anti LRRC36 pAb (ATL-HPA058479 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA058479-25

• 

Protein Description: leucine rich repeat containing 36
Gene Name: LRRC36
Alternative Gene Name: FLJ11004
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054320: 80%, ENSRNOG00000015465: 29%
Entrez Gene ID: 55282
Uniprot ID: Q1X8D7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IVSGQQSHTYDDLLHKNQQLTMQVACLNQELAQLKKLEKTVAILHESQRSLVVTNEYLLQQLNKEPKGYSGKALLPPENGHHL
• Gene Sequence: IVSGQQSHTYDDLLHKNQQLTMQVACLNQELAQLKKLEKTVAILHESQRSLVVTNEYLLQQLNKEPKGYSGKALLPPENGHHL
• Gene ID - Mouse: ENSMUSG00000054320
• Gene ID - Rat: ENSRNOG00000015465
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.