Anti LRRC36 pAb (ATL-HPA055237)

Atlas Antibodies

SKU:
ATL-HPA055237-25
  • Immunohistochemical staining of human caudate shows strong cytoplasmic and nuclear positivity in astrocytes.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 36
Gene Name: LRRC36
Alternative Gene Name: FLJ11004
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054320: 75%, ENSRNOG00000048113: 30%
Entrez Gene ID: 55282
Uniprot ID: Q1X8D7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FIPFPNREIKDSLSTSATQGNGTRDQKLDTFPLGTQTQEVARREMPSDNHQEDEFRHYSPRQSTVRSPEKMTREGYQVSF
Gene Sequence FIPFPNREIKDSLSTSATQGNGTRDQKLDTFPLGTQTQEVARREMPSDNHQEDEFRHYSPRQSTVRSPEKMTREGYQVSF
Gene ID - Mouse ENSMUSG00000054320
Gene ID - Rat ENSRNOG00000048113
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LRRC36 pAb (ATL-HPA055237)
Datasheet Anti LRRC36 pAb (ATL-HPA055237) Datasheet (External Link)
Vendor Page Anti LRRC36 pAb (ATL-HPA055237) at Atlas Antibodies

Documents & Links for Anti LRRC36 pAb (ATL-HPA055237)
Datasheet Anti LRRC36 pAb (ATL-HPA055237) Datasheet (External Link)
Vendor Page Anti LRRC36 pAb (ATL-HPA055237)