Anti LRRC32 pAb (ATL-HPA058434)

Atlas Antibodies

SKU: ATL-HPA058434-25

• 

Protein Description: leucine rich repeat containing 32
Gene Name: LRRC32
Alternative Gene Name: D11S833E, GARP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090958: 94%, ENSRNOG00000015310: 96%
Entrez Gene ID: 2615
Uniprot ID: Q14392
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEK
• Gene Sequence: GNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEK
• Gene ID - Mouse: ENSMUSG00000090958
• Gene ID - Rat: ENSRNOG00000015310
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.