Anti LRRC23 pAb (ATL-HPA057533 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA057533-25

• 
• 

Protein Description: leucine rich repeat containing 23
Gene Name: LRRC23
Alternative Gene Name: B7, LRPB7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030125: 84%, ENSRNOG00000047890: 81%
Entrez Gene ID: 10233
Uniprot ID: Q53EV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKADGNRLRSAQMNELPYLQIASFAYNQITDTEGISHPRLETLNLKGNSIHMVTGLDPEKLISLHTVELRGNQLESTLGINLPKLKNLYLA
• Gene Sequence: LKADGNRLRSAQMNELPYLQIASFAYNQITDTEGISHPRLETLNLKGNSIHMVTGLDPEKLISLHTVELRGNQLESTLGINLPKLKNLYLA
• Gene ID - Mouse: ENSMUSG00000030125
• Gene ID - Rat: ENSRNOG00000047890
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.