Protein Description: low density lipoprotein receptor-related protein 2
Gene Name: LRP2
Alternative Gene Name: DBS, gp330
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027070: 82%, ENSRNOG00000056184: 79%
Entrez Gene ID: 4036
Uniprot ID: P98164
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LRP2
Alternative Gene Name: DBS, gp330
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027070: 82%, ENSRNOG00000056184: 79%
Entrez Gene ID: 4036
Uniprot ID: P98164
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | NNDRIYWSDFKEDVIETIKYDGTDRRVIAKEAMNPYSLDIFEDQLYWISKEKGEVWKQNKFGQGKKEKTLVVNPWLTQVRIFHQLRYNKSVP |
Documents & Links for Anti LRP2 pAb (ATL-HPA064792 w/enhanced validation) | |
Datasheet | Anti LRP2 pAb (ATL-HPA064792 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LRP2 pAb (ATL-HPA064792 w/enhanced validation) at Atlas |
Documents & Links for Anti LRP2 pAb (ATL-HPA064792 w/enhanced validation) | |
Datasheet | Anti LRP2 pAb (ATL-HPA064792 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LRP2 pAb (ATL-HPA064792 w/enhanced validation) |