Anti LRP2 pAb (ATL-HPA064792 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA064792-25

• 

Protein Description: low density lipoprotein receptor-related protein 2
Gene Name: LRP2
Alternative Gene Name: DBS, gp330
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027070: 82%, ENSRNOG00000056184: 79%
Entrez Gene ID: 4036
Uniprot ID: P98164
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NNDRIYWSDFKEDVIETIKYDGTDRRVIAKEAMNPYSLDIFEDQLYWISKEKGEVWKQNKFGQGKKEKTLVVNPWLTQVRIFHQLRYNKSVP
• Gene Sequence: NNDRIYWSDFKEDVIETIKYDGTDRRVIAKEAMNPYSLDIFEDQLYWISKEKGEVWKQNKFGQGKKEKTLVVNPWLTQVRIFHQLRYNKSVP
• Gene ID - Mouse: ENSMUSG00000027070
• Gene ID - Rat: ENSRNOG00000056184
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.