Protein Description: low density lipoprotein receptor-related protein 11
Gene Name: LRP11
Alternative Gene Name: bA350J20.3, MANSC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019796: 81%, ENSRNOG00000014303: 79%
Entrez Gene ID: 84918
Uniprot ID: Q86VZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LRP11
Alternative Gene Name: bA350J20.3, MANSC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019796: 81%, ENSRNOG00000014303: 79%
Entrez Gene ID: 84918
Uniprot ID: Q86VZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TDTAGQRSSDNVSVTVLRAAYSTGGCLHTCSRYHFFCDDGCCIDITLACDGVQQCPDG |
| Documents & Links for Anti LRP11 pAb (ATL-HPA064002) | |
| Datasheet | Anti LRP11 pAb (ATL-HPA064002) Datasheet (External Link) |
| Vendor Page | Anti LRP11 pAb (ATL-HPA064002) at Atlas |
| Documents & Links for Anti LRP11 pAb (ATL-HPA064002) | |
| Datasheet | Anti LRP11 pAb (ATL-HPA064002) Datasheet (External Link) |
| Vendor Page | Anti LRP11 pAb (ATL-HPA064002) |