Anti LRP11 pAb (ATL-HPA064002)

Atlas Antibodies

SKU:
ATL-HPA064002-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: low density lipoprotein receptor-related protein 11
Gene Name: LRP11
Alternative Gene Name: bA350J20.3, MANSC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019796: 81%, ENSRNOG00000014303: 79%
Entrez Gene ID: 84918
Uniprot ID: Q86VZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TDTAGQRSSDNVSVTVLRAAYSTGGCLHTCSRYHFFCDDGCCIDITLACDGVQQCPDG
Gene Sequence TDTAGQRSSDNVSVTVLRAAYSTGGCLHTCSRYHFFCDDGCCIDITLACDGVQQCPDG
Gene ID - Mouse ENSMUSG00000019796
Gene ID - Rat ENSRNOG00000014303
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LRP11 pAb (ATL-HPA064002)
Datasheet Anti LRP11 pAb (ATL-HPA064002) Datasheet (External Link)
Vendor Page Anti LRP11 pAb (ATL-HPA064002) at Atlas Antibodies

Documents & Links for Anti LRP11 pAb (ATL-HPA064002)
Datasheet Anti LRP11 pAb (ATL-HPA064002) Datasheet (External Link)
Vendor Page Anti LRP11 pAb (ATL-HPA064002)