Anti LRP11 pAb (ATL-HPA064002)
Atlas Antibodies
- SKU:
- ATL-HPA064002-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LRP11
Alternative Gene Name: bA350J20.3, MANSC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019796: 81%, ENSRNOG00000014303: 79%
Entrez Gene ID: 84918
Uniprot ID: Q86VZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TDTAGQRSSDNVSVTVLRAAYSTGGCLHTCSRYHFFCDDGCCIDITLACDGVQQCPDG |
Gene Sequence | TDTAGQRSSDNVSVTVLRAAYSTGGCLHTCSRYHFFCDDGCCIDITLACDGVQQCPDG |
Gene ID - Mouse | ENSMUSG00000019796 |
Gene ID - Rat | ENSRNOG00000014303 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LRP11 pAb (ATL-HPA064002) | |
Datasheet | Anti LRP11 pAb (ATL-HPA064002) Datasheet (External Link) |
Vendor Page | Anti LRP11 pAb (ATL-HPA064002) at Atlas Antibodies |
Documents & Links for Anti LRP11 pAb (ATL-HPA064002) | |
Datasheet | Anti LRP11 pAb (ATL-HPA064002) Datasheet (External Link) |
Vendor Page | Anti LRP11 pAb (ATL-HPA064002) |