Protein Description: leucine rich repeat and fibronectin type III domain containing 2
Gene Name: LRFN2
Alternative Gene Name: FIGLER2, KIAA1246, SALM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040490: 95%, ENSRNOG00000011803: 97%
Entrez Gene ID: 57497
Uniprot ID: Q9ULH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LRFN2
Alternative Gene Name: FIGLER2, KIAA1246, SALM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040490: 95%, ENSRNOG00000011803: 97%
Entrez Gene ID: 57497
Uniprot ID: Q9ULH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PWRIPPSAPRPKPSLDRLMGAFASLDLKSQRKEELLDSRTPAGRGAGTSARGHHSDREPLL |
Documents & Links for Anti LRFN2 pAb (ATL-HPA076660 w/enhanced validation) | |
Datasheet | Anti LRFN2 pAb (ATL-HPA076660 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LRFN2 pAb (ATL-HPA076660 w/enhanced validation) at Atlas |
Documents & Links for Anti LRFN2 pAb (ATL-HPA076660 w/enhanced validation) | |
Datasheet | Anti LRFN2 pAb (ATL-HPA076660 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LRFN2 pAb (ATL-HPA076660 w/enhanced validation) |