Anti LPCAT4 pAb (ATL-HPA057321)

Atlas Antibodies

SKU: ATL-HPA057321-25

• 

Protein Description: lysophosphatidylcholine acyltransferase 4
Gene Name: LPCAT4
Alternative Gene Name: AGPAT7, AYTL3, FLJ10257, LPAAT-eta, LPEAT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027134: 88%, ENSRNOG00000005058: 89%
Entrez Gene ID: 254531
Uniprot ID: Q643R3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATECEFVGSLPVIVVGRLKVALEPQLWELGKVLRKAGLSAGYVDAGAEPGRSRMISQEEFARQLQLSDPQTVAGAFGYFQQDT
• Gene Sequence: ATECEFVGSLPVIVVGRLKVALEPQLWELGKVLRKAGLSAGYVDAGAEPGRSRMISQEEFARQLQLSDPQTVAGAFGYFQQDT
• Gene ID - Mouse: ENSMUSG00000027134
• Gene ID - Rat: ENSRNOG00000005058
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.