Anti LPAR4 pAb (ATL-HPA046563)

Atlas Antibodies

SKU: ATL-HPA046563-25

• 

Protein Description: lysophosphatidic acid receptor 4
Gene Name: LPAR4
Alternative Gene Name: GPR23, LPA4, P2RY9, P2Y5-LIKE, P2Y9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049929: 96%, ENSRNOG00000002428: 96%
Entrez Gene ID: 2846
Uniprot ID: Q99677
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELM
• Gene Sequence: KSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELM
• Gene ID - Mouse: ENSMUSG00000049929
• Gene ID - Rat: ENSRNOG00000002428
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.