Anti LPA pAb (ATL-HPA060604)
Atlas Antibodies
- SKU:
- ATL-HPA060604-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: LPA
Alternative Gene Name: LP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059481: 39%, ENSRNOG00000017223: 39%
Entrez Gene ID: 4018
Uniprot ID: P08519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WEYCNLTQCSETESGVLETPTVVPVPSMEAHSEAAPTEQTPVVRQCYHG |
Gene Sequence | WEYCNLTQCSETESGVLETPTVVPVPSMEAHSEAAPTEQTPVVRQCYHG |
Gene ID - Mouse | ENSMUSG00000059481 |
Gene ID - Rat | ENSRNOG00000017223 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LPA pAb (ATL-HPA060604) | |
Datasheet | Anti LPA pAb (ATL-HPA060604) Datasheet (External Link) |
Vendor Page | Anti LPA pAb (ATL-HPA060604) at Atlas Antibodies |
Documents & Links for Anti LPA pAb (ATL-HPA060604) | |
Datasheet | Anti LPA pAb (ATL-HPA060604) Datasheet (External Link) |
Vendor Page | Anti LPA pAb (ATL-HPA060604) |