Anti LONRF2 pAb (ATL-HPA057366)

Atlas Antibodies

SKU: ATL-HPA057366-25

• 
• 

Protein Description: LON peptidase N-terminal domain and ring finger 2
Gene Name: LONRF2
Alternative Gene Name: FLJ45273, RNF192
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048814: 56%, ENSRNOG00000023312: 82%
Entrez Gene ID: 164832
Uniprot ID: Q1L5Z9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAPDDNSLLLLRAELYLTMKNYEQALQDASAACQNEPLLIKGHQVKAQALSGLGRSKEVLKEFLYC
• Gene Sequence: LAPDDNSLLLLRAELYLTMKNYEQALQDASAACQNEPLLIKGHQVKAQALSGLGRSKEVLKEFLYC
• Gene ID - Mouse: ENSMUSG00000048814
• Gene ID - Rat: ENSRNOG00000023312
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.