Anti LMO7DN pAb (ATL-HPA052013)
Atlas Antibodies
- SKU:
- ATL-HPA052013-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LMO7DN
Alternative Gene Name: C13orf45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022680: 28%, ENSRNOG00000055103: 26%
Entrez Gene ID: 729420
Uniprot ID: F2Z398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MTWLDKGVWTQEDENSCSFSESDFPGCRDQINPSIPSIWTAVSGMMISLEVRWWIKGKQGYVISLGHA |
Gene Sequence | MTWLDKGVWTQEDENSCSFSESDFPGCRDQINPSIPSIWTAVSGMMISLEVRWWIKGKQGYVISLGHA |
Gene ID - Mouse | ENSMUSG00000022680 |
Gene ID - Rat | ENSRNOG00000055103 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LMO7DN pAb (ATL-HPA052013) | |
Datasheet | Anti LMO7DN pAb (ATL-HPA052013) Datasheet (External Link) |
Vendor Page | Anti LMO7DN pAb (ATL-HPA052013) at Atlas Antibodies |
Documents & Links for Anti LMO7DN pAb (ATL-HPA052013) | |
Datasheet | Anti LMO7DN pAb (ATL-HPA052013) Datasheet (External Link) |
Vendor Page | Anti LMO7DN pAb (ATL-HPA052013) |