Anti LMNTD1 pAb (ATL-HPA045911)

Atlas Antibodies

SKU:
ATL-HPA045911-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: lamin tail domain containing 1
Gene Name: LMNTD1
Alternative Gene Name: FLJ36004, IFLTD1, Pas1c1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054966: 68%, ENSRNOG00000015910: 65%
Entrez Gene ID: 160492
Uniprot ID: Q8N9Z9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SEAKHQPPSDFLWKEQDKFRASPDCITILCKPNGQAIAWYTPIHWKQAWEKLDADVEFNRCSVVSPTFRKRVFQWTASTATITKE
Gene Sequence SEAKHQPPSDFLWKEQDKFRASPDCITILCKPNGQAIAWYTPIHWKQAWEKLDADVEFNRCSVVSPTFRKRVFQWTASTATITKE
Gene ID - Mouse ENSMUSG00000054966
Gene ID - Rat ENSRNOG00000015910
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LMNTD1 pAb (ATL-HPA045911)
Datasheet Anti LMNTD1 pAb (ATL-HPA045911) Datasheet (External Link)
Vendor Page Anti LMNTD1 pAb (ATL-HPA045911) at Atlas Antibodies

Documents & Links for Anti LMNTD1 pAb (ATL-HPA045911)
Datasheet Anti LMNTD1 pAb (ATL-HPA045911) Datasheet (External Link)
Vendor Page Anti LMNTD1 pAb (ATL-HPA045911)