Anti LMNB1 pAb (ATL-HPA050524 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA050524-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: LMNB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024590: 100%, ENSRNOG00000013774: 100%
Entrez Gene ID: 4001
Uniprot ID: P20700
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLK |
Gene Sequence | RTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLK |
Gene ID - Mouse | ENSMUSG00000024590 |
Gene ID - Rat | ENSRNOG00000013774 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LMNB1 pAb (ATL-HPA050524 w/enhanced validation) | |
Datasheet | Anti LMNB1 pAb (ATL-HPA050524 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LMNB1 pAb (ATL-HPA050524 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti LMNB1 pAb (ATL-HPA050524 w/enhanced validation) | |
Datasheet | Anti LMNB1 pAb (ATL-HPA050524 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LMNB1 pAb (ATL-HPA050524 w/enhanced validation) |
Citations for Anti LMNB1 pAb (ATL-HPA050524 w/enhanced validation) – 3 Found |
Nordholm, Johan; Petitou, Jeanne; Östbye, Henrik; da Silva, Diogo V; Dou, Dan; Wang, Hao; Daniels, Robert. Translational regulation of viral secretory proteins by the 5' coding regions and a viral RNA-binding protein. The Journal Of Cell Biology. 2017;216(8):2283-2293. PubMed |
Wurlitzer, Marcus; Möckelmann, Nikolaus; Kriegs, Malte; Vens, Maren; Omidi, Maryam; Hoffer, Konstantin; Bargen, Clara von; Möller-Koop, Christina; Witt, Melanie; Droste, Conrad; Oetting, Agnes; Petersen, Hannes; Busch, Chia-Jung; Münscher, Adrian; Schlüter, Hartmut; Clauditz, Till Sebastian; Rieckmann, Thorsten. Mass Spectrometric Comparison of HPV-Positive and HPV-Negative Oropharyngeal Cancer. Cancers. 2020;12(6) PubMed |
Wang, Yinuo; Elsherbiny, Adel; Kessler, Linda; Cordero, Julio; Shi, Haojie; Serke, Heike; Lityagina, Olga; Trogisch, Felix A; Mohammadi, Mona Malek; El-Battrawy, Ibrahim; Backs, Johannes; Wieland, Thomas; Heineke, Joerg; Dobreva, Gergana. Lamin A/C-dependent chromatin architecture safeguards naïve pluripotency to prevent aberrant cardiovascular cell fate and function. Nature Communications. 2022;13(1):6663. PubMed |