Anti LMCD1 pAb (ATL-HPA024059 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024059-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: LMCD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057604: 90%, ENSRNOG00000005690: 90%
Entrez Gene ID: 29995
Uniprot ID: Q9NZU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGA |
| Gene Sequence | QLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGA |
| Gene ID - Mouse | ENSMUSG00000057604 |
| Gene ID - Rat | ENSRNOG00000005690 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LMCD1 pAb (ATL-HPA024059 w/enhanced validation) | |
| Datasheet | Anti LMCD1 pAb (ATL-HPA024059 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LMCD1 pAb (ATL-HPA024059 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti LMCD1 pAb (ATL-HPA024059 w/enhanced validation) | |
| Datasheet | Anti LMCD1 pAb (ATL-HPA024059 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LMCD1 pAb (ATL-HPA024059 w/enhanced validation) |
| Citations for Anti LMCD1 pAb (ATL-HPA024059 w/enhanced validation) – 4 Found |
| Cuello, Friederike; Knaust, Anika E; Saleem, Umber; Loos, Malte; Raabe, Janice; Mosqueira, Diogo; Laufer, Sandra; Schweizer, Michaela; van der Kraak, Petra; Flenner, Frederik; Ulmer, Bärbel M; Braren, Ingke; Yin, Xiaoke; Theofilatos, Konstantinos; Ruiz-Orera, Jorge; Patone, Giannino; Klampe, Birgit; Schulze, Thomas; Piasecki, Angelika; Pinto, Yigal; Vink, Aryan; Hübner, Norbert; Harding, Sian; Mayr, Manuel; Denning, Chris; Eschenhagen, Thomas; Hansen, Arne. Impairment of the ER/mitochondria compartment in human cardiomyocytes with PLN p.Arg14del mutation. Embo Molecular Medicine. 2021;13(6):e13074. PubMed |
| Li, Amy; Ponten, Fredrik; dos Remedios, Cristobal G. The interactome of LIM domain proteins: the contributions of LIM domain proteins to heart failure and heart development. Proteomics. 2012;12(2):203-25. PubMed |
| Govatati, Suresh; Pichavaram, Prahalathan; Janjanam, Jagadeesh; Guo, Liang; Virmani, Renu; Rao, Gadiparthi N. Myristoylation of LMCD1 Leads to Its Species-Specific Derepression of E2F1 and NFATc1 in the Modulation of CDC6 and IL-33 Expression During Development of Vascular Lesions. Arteriosclerosis, Thrombosis, And Vascular Biology. 2020;40(5):1256-1274. PubMed |
| Wu, Haohao; Petitpré, Charles; Fontanet, Paula; Sharma, Anil; Bellardita, Carmelo; Quadros, Rolen M; Jannig, Paulo R; Wang, Yiqiao; Heimel, J Alexander; Cheung, Kylie K Y; Wanderoy, Simone; Xuan, Yang; Meletis, Konstantinos; Ruas, Jorge; Gurumurthy, Channabasavaiah B; Kiehn, Ole; Hadjab, Saida; Lallemend, François. Distinct subtypes of proprioceptive dorsal root ganglion neurons regulate adaptive proprioception in mice. Nature Communications. 2021;12(1):1026. PubMed |