Anti LLPH pAb (ATL-HPA048920)

Atlas Antibodies

Catalog No.:
ATL-HPA048920-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: LLP homolog, long-term synaptic facilitation (Aplysia)
Gene Name: LLPH
Alternative Gene Name: C12orf31, hLLP, MGC14817
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020224: 72%, ENSRNOG00000004316: 81%
Entrez Gene ID: 84298
Uniprot ID: Q9BRT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KMQCEVKDEKDDMKMETDIKRNKKTLLDQHGQYPIWMNQRQRKRLKAKREKRKGKSKAKAVKVAKG
Gene Sequence KMQCEVKDEKDDMKMETDIKRNKKTLLDQHGQYPIWMNQRQRKRLKAKREKRKGKSKAKAVKVAKG
Gene ID - Mouse ENSMUSG00000020224
Gene ID - Rat ENSRNOG00000004316
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LLPH pAb (ATL-HPA048920)
Datasheet Anti LLPH pAb (ATL-HPA048920) Datasheet (External Link)
Vendor Page Anti LLPH pAb (ATL-HPA048920) at Atlas Antibodies

Documents & Links for Anti LLPH pAb (ATL-HPA048920)
Datasheet Anti LLPH pAb (ATL-HPA048920) Datasheet (External Link)
Vendor Page Anti LLPH pAb (ATL-HPA048920)