Anti LIPJ pAb (ATL-HPA048594)

Atlas Antibodies

SKU:
ATL-HPA048594-25
  • Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: lipase, family member J
Gene Name: LIPJ
Alternative Gene Name: bA425M17.2, LIPL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056078: 44%, ENSRNOG00000049161: 47%
Entrez Gene ID: 142910
Uniprot ID: Q5W064
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHIYYKTISYYNHIDSLFGLDVYDQVYHEIIDIIQD
Gene Sequence YNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHIYYKTISYYNHIDSLFGLDVYDQVYHEIIDIIQD
Gene ID - Mouse ENSMUSG00000056078
Gene ID - Rat ENSRNOG00000049161
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LIPJ pAb (ATL-HPA048594)
Datasheet Anti LIPJ pAb (ATL-HPA048594) Datasheet (External Link)
Vendor Page Anti LIPJ pAb (ATL-HPA048594) at Atlas Antibodies

Documents & Links for Anti LIPJ pAb (ATL-HPA048594)
Datasheet Anti LIPJ pAb (ATL-HPA048594) Datasheet (External Link)
Vendor Page Anti LIPJ pAb (ATL-HPA048594)