Anti LIPH pAb (ATL-HPA049079)

Atlas Antibodies

SKU: ATL-HPA049079-25

• 

Protein Description: lipase, member H
Gene Name: LIPH
Alternative Gene Name: LPDLR, mPA-PLA1, mPA-PLA1alpha, PLA1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044626: 73%, ENSRNOG00000033441: 49%
Entrez Gene ID: 200879
Uniprot ID: Q8WWY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GCPKTILGGFQYFKCDHQRSVYLYLSSLRESCTITAYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYADNWKDHL
• Gene Sequence: GCPKTILGGFQYFKCDHQRSVYLYLSSLRESCTITAYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYADNWKDHL
• Gene ID - Mouse: ENSMUSG00000044626
• Gene ID - Rat: ENSRNOG00000033441
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.