Anti LIPF pAb (ATL-HPA045930 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA045930-25

• 
• 

Protein Description: lipase, gastric
Gene Name: LIPF
Alternative Gene Name: HGL, HLAL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024768: 79%, ENSRNOG00000019448: 74%
Entrez Gene ID: 8513
Uniprot ID: P07098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDK
• Gene Sequence: GGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDK
• Gene ID - Mouse: ENSMUSG00000024768
• Gene ID - Rat: ENSRNOG00000019448
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.