Anti LINGO4 pAb (ATL-HPA060781)

Atlas Antibodies

SKU: ATL-HPA060781-25

• 

Protein Description: leucine rich repeat and Ig domain containing 4
Gene Name: LINGO4
Alternative Gene Name: LRRN6D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044505: 98%, ENSRNOG00000022863: 96%
Entrez Gene ID: 339398
Uniprot ID: Q6UY18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNITVP
• Gene Sequence: GTLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNITVP
• Gene ID - Mouse: ENSMUSG00000044505
• Gene ID - Rat: ENSRNOG00000022863
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.