Anti LIN37 pAb (ATL-HPA047809)

Atlas Antibodies

SKU:
ATL-HPA047809-25
  • Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria.
  • Western blot analysis in human cell line HDLM-2.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: lin-37 DREAM MuvB core complex component
Gene Name: LIN37
Alternative Gene Name: F25965, lin-37, ZK418.4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036845: 95%, ENSRNOG00000020929: 93%
Entrez Gene ID: 55957
Uniprot ID: Q96GY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPGDACRSRIPSPLQPEMQGTPDDEPSEPEPSPSTLIYRNMQRWKRIRQRWKEASHRNQLRYSESMKILREMYERQ
Gene Sequence PPGDACRSRIPSPLQPEMQGTPDDEPSEPEPSPSTLIYRNMQRWKRIRQRWKEASHRNQLRYSESMKILREMYERQ
Gene ID - Mouse ENSMUSG00000036845
Gene ID - Rat ENSRNOG00000020929
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LIN37 pAb (ATL-HPA047809)
Datasheet Anti LIN37 pAb (ATL-HPA047809) Datasheet (External Link)
Vendor Page Anti LIN37 pAb (ATL-HPA047809) at Atlas Antibodies

Documents & Links for Anti LIN37 pAb (ATL-HPA047809)
Datasheet Anti LIN37 pAb (ATL-HPA047809) Datasheet (External Link)
Vendor Page Anti LIN37 pAb (ATL-HPA047809)