Anti LIMA1 pAb (ATL-HPA052645 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA052645-25
  • Immunohistochemistry analysis in human rectum and liver tissues using HPA052645 antibody. Corresponding LIMA1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane, actin filaments & focal adhesion sites.
  • Western blot analysis in human cell lines A-431 and A-549 using Anti-LIMA1 antibody. Corresponding LIMA1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: LIM domain and actin binding 1
Gene Name: LIMA1
Alternative Gene Name: EPLIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023022: 85%, ENSRNOG00000059801: 82%
Entrez Gene ID: 51474
Uniprot ID: Q9UHB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RPHKDLWASKNENEEILERPAQLANARETPHSPGVEDAPIAKVGVLAASMEAKASSQQEKEDKPAETKKLRIAWPPPTELGSSGSALEEGI
Gene Sequence RPHKDLWASKNENEEILERPAQLANARETPHSPGVEDAPIAKVGVLAASMEAKASSQQEKEDKPAETKKLRIAWPPPTELGSSGSALEEGI
Gene ID - Mouse ENSMUSG00000023022
Gene ID - Rat ENSRNOG00000059801
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LIMA1 pAb (ATL-HPA052645 w/enhanced validation)
Datasheet Anti LIMA1 pAb (ATL-HPA052645 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LIMA1 pAb (ATL-HPA052645 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti LIMA1 pAb (ATL-HPA052645 w/enhanced validation)
Datasheet Anti LIMA1 pAb (ATL-HPA052645 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LIMA1 pAb (ATL-HPA052645 w/enhanced validation)