Protein Description: LIM homeobox 8
Gene Name: LHX8
Alternative Gene Name: Lhx7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096225: 92%, ENSRNOG00000028348: 54%
Entrez Gene ID: 431707
Uniprot ID: Q68G74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: LHX8
Alternative Gene Name: Lhx7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096225: 92%, ENSRNOG00000028348: 54%
Entrez Gene ID: 431707
Uniprot ID: Q68G74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LEEMAYSAYVPQDGTMLTALHSYMDAHSPTTLGLQPLLPHSMTQLPISHT |
| Documents & Links for Anti LHX8 pAb (ATL-HPA071806) | |
| Datasheet | Anti LHX8 pAb (ATL-HPA071806) Datasheet (External Link) |
| Vendor Page | Anti LHX8 pAb (ATL-HPA071806) at Atlas |
| Documents & Links for Anti LHX8 pAb (ATL-HPA071806) | |
| Datasheet | Anti LHX8 pAb (ATL-HPA071806) Datasheet (External Link) |
| Vendor Page | Anti LHX8 pAb (ATL-HPA071806) |