Anti LHX8 pAb (ATL-HPA071806)
Atlas Antibodies
- SKU:
- ATL-HPA071806-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LHX8
Alternative Gene Name: Lhx7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096225: 92%, ENSRNOG00000028348: 54%
Entrez Gene ID: 431707
Uniprot ID: Q68G74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LEEMAYSAYVPQDGTMLTALHSYMDAHSPTTLGLQPLLPHSMTQLPISHT |
Gene Sequence | LEEMAYSAYVPQDGTMLTALHSYMDAHSPTTLGLQPLLPHSMTQLPISHT |
Gene ID - Mouse | ENSMUSG00000096225 |
Gene ID - Rat | ENSRNOG00000028348 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LHX8 pAb (ATL-HPA071806) | |
Datasheet | Anti LHX8 pAb (ATL-HPA071806) Datasheet (External Link) |
Vendor Page | Anti LHX8 pAb (ATL-HPA071806) at Atlas Antibodies |
Documents & Links for Anti LHX8 pAb (ATL-HPA071806) | |
Datasheet | Anti LHX8 pAb (ATL-HPA071806) Datasheet (External Link) |
Vendor Page | Anti LHX8 pAb (ATL-HPA071806) |